PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_000355-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family HD-ZIP
Protein Properties Length: 282aa    MW: 31135.7 Da    PI: 6.6467
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_000355-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.83.7e-18106159356
                      --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      k+++++ eq+++Le+ Fe  +++  e++ +LAk lgL+ rq+ +WFqNrRa++k
  AHYPO_000355-RA 106 KKRRLNMEQVKTLEKNFELGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWK 159
                      456899***********************************************9 PP

2HD-ZIP_I/II131.72.9e-42105196192
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                      ekkrrl+ eqvk+LE++Fe  +kLeperK++la++Lglqprq+a+WFqnrRAR+ktkqlEkdy++Lkr++dalk++n++L++++++L+++l+
  AHYPO_000355-RA 105 EKKRRLNMEQVKTLEKNFELGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWKTKQLEKDYDVLKRQFDALKADNDALQAQNQKLQAQLD 196
                      69**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.75E-1995163IPR009057Homeodomain-like
PROSITE profilePS5007116.763101161IPR001356Homeobox domain
SMARTSM003891.0E-17104165IPR001356Homeobox domain
PfamPF000461.8E-15106159IPR001356Homeobox domain
CDDcd000861.02E-16106162No hitNo description
Gene3DG3DSA:1.10.10.602.5E-19108168IPR009057Homeodomain-like
PRINTSPR000319.8E-6132141IPR000047Helix-turn-helix motif
PROSITE patternPS000270136159IPR017970Homeobox, conserved site
PRINTSPR000319.8E-6141157IPR000047Helix-turn-helix motif
CDDcd146869.22E-4152196No hitNo description
PfamPF021831.0E-14161195IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MSTTCSGMAF FPTNFMLQTP DHNDNHPPPS LSGMLPSCTP QDFHVGGGGM GAILGKRSMS  60
FSGIDMCEDT NGHHNNHNHN HNHNGGGGGE EELSDDGSQL GGVGEKKRRL NMEQVKTLEK  120
NFELGNKLEP ERKMQLAKAL GLQPRQIAIW FQNRRARWKT KQLEKDYDVL KRQFDALKAD  180
NDALQAQNQK LQAQLDISRT PTTTESPLDL SAHQTTTAAT TTASGITLFP QSSMRPNGPA  240
QVLFHSPQPS SSVKEETFTS MFCGIDDQTG FWPWLEHQNF N*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1153161RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010683230.11e-148PREDICTED: homeobox-leucine zipper protein ATHB-13
RefseqXP_010683229.11e-148PREDICTED: homeobox-leucine zipper protein ATHB-13
RefseqXP_010681986.11e-148PREDICTED: homeobox-leucine zipper protein ATHB-13-like
RefseqXP_010681985.11e-148PREDICTED: homeobox-leucine zipper protein ATHB-13-like
SwissprotQ8LC032e-84ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLA0A0J8C6V71e-137A0A0J8C6V7_BETVU; Uncharacterized protein
STRINGVIT_01s0026g01950.t011e-112(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.13e-73HD-ZIP family protein